PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC26857_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 177aa    MW: 18927.7 Da    PI: 9.2621
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC26857_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.63.2e-163191257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 r+R+++++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  RrC26857_p1 31 RSRWSPKPEQILILESIFNSgMVNPPKEETVRIRKMLekfgTVGDANVFYWFQNRRSRSRR 91
                 89*****************99*************************************997 PP

2Wus_type_Homeobox108.24.8e-353093265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++G ++d+NVfyWFQNr++R+r++q
        RrC26857_p1 30 VRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGTVGDANVFYWFQNRRSRSRRRQ 93
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.06E-152298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-92598IPR009057Homeodomain-like
PROSITE profilePS5007111.4832792IPR001356Homeobox domain
SMARTSM003892.0E-62996IPR001356Homeobox domain
PfamPF000465.7E-143191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MDQEQTPHSP TGHSHSPSSS ASGSTSTETV RSRWSPKPEQ ILILESIFNS GMVNPPKEET  60
VRIRKMLEKF GTVGDANVFY WFQNRRSRSR RRQRQLQAAA AAAAATTNTC EQTMMVNTSL  120
PQYSGGDLGF GGCSTSSNYL YGGSSSQAPS FFLGLSSSPP CSSSSSTSSS ASSSTFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATAC0093271e-170AC009327.8 Arabidopsis thaliana chromosome III BAC T12J13 genomic sequence, complete sequence.
GenBankCP0026861e-170CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118563.11e-78WUSCHEL related homeobox 11
SwissprotQ6X7J32e-73WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLB3H5D32e-78B3H5D3_ARATH; WUSCHEL related homeobox 11
STRINGAT3G03660.25e-78(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.25e-60WUSCHEL related homeobox 11